PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021341-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 76aa    MW: 8758.5 Da    PI: 4.0944
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021341-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.61.8e-102667144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     ++ ++++E+ l+ + +++ G + W++Ia +++ gRt++++  +w
    NNU_021341-RA 26 KLEFSEDEETLISRMFNLVGER-WSLIAGRIP-GRTAEEIEKYW 67
                     678*******************.*********.**********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.472167IPR017877Myb-like domain
SMARTSM007178.0E-82573IPR001005SANT/Myb domain
PfamPF002493.8E-92767IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-122868IPR009057Homeodomain-like
CDDcd001679.70E-82867No hitNo description
SuperFamilySSF466893.12E-82868IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MGDFQHSSDD SSQDFTEPDV ISRDSKLEFS EDEETLISRM FNLVGERWSL IAGRIPGRTA  60
EEIEKYWTCK YSSSSE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278685.16e-50PREDICTED: transcription factor CPC-like
SwissprotO220594e-18CPC_ARATH; Transcription factor CPC
TrEMBLD7TEM74e-33D7TEM7_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02360.t011e-32(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.16e-19MYB_related family protein